Lineage for d2c7bb_ (2c7b B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2510660Species Uncultured archaeon [TaxId:115547] [187518] (1 PDB entry)
  8. 2510662Domain d2c7bb_: 2c7b B: [163272]
    automated match to d1jjia_

Details for d2c7bb_

PDB Entry: 2c7b (more details), 2.3 Å

PDB Description: the crystal structure of este1, a new thermophilic and thermostable carboxylesterase cloned from a metagenomic library
PDB Compounds: (B:) carboxylesterase

SCOPe Domain Sequences for d2c7bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c7bb_ c.69.1.0 (B:) automated matches {Uncultured archaeon [TaxId: 115547]}
aspqelrrqveeqsrlltaavqepiaetrdvhipvsggsirarvyfpkkaaglpavlyyh
gggfvfgsiethdhicrrlsrlsdsvvvsvdyrlapeykfptavedayaalkwvadrade
lgvdpdriavagdsaggnlaavvsildrnsgeklvkkqvliypvvnmtgvptaslvefgv
aettslpielmvwfgrqylkrpeeaydfkasplladlgglppalvvtaeydplrdegely
aykmkasgsravavrfagmvhgfvsfypfvdagrealdlaaasirsglqps

SCOPe Domain Coordinates for d2c7bb_:

Click to download the PDB-style file with coordinates for d2c7bb_.
(The format of our PDB-style files is described here.)

Timeline for d2c7bb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2c7ba_