Lineage for d2c74b_ (2c74 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1279239Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 1279240Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 1279286Protein automated matches [190238] (5 species)
    not a true protein
  7. 1279295Species Human (Homo sapiens) [TaxId:9606] [187008] (37 PDB entries)
  8. 1279333Domain d2c74b_: 2c74 B: [163270]
    automated match to d1qjba_
    complexed with cit

Details for d2c74b_

PDB Entry: 2c74 (more details), 2.7 Å

PDB Description: 14-3-3 protein eta (human) complexed to peptide
PDB Compounds: (B:) 14-3-3 protein eta

SCOPe Domain Sequences for d2c74b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c74b_ a.118.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdreqllqrarlaeqaeryddmasamkavtelneplsnedrnllsvayknvvgarrsswr
vissieqktmadgnekklekvkayrekiekeletvcndvlslldkflikncndfqyeskv
fylkmkgdyyrylaevasgekknsvveaseaaykeafeiskeqmqpthpirlglalnfsv
fyyeiqnapeqacllakqafddaiaeldtlnedsykdstlimqllrdnltlwts

SCOPe Domain Coordinates for d2c74b_:

Click to download the PDB-style file with coordinates for d2c74b_.
(The format of our PDB-style files is described here.)

Timeline for d2c74b_: