Lineage for d2c74a_ (2c74 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726458Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2726459Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2726519Protein automated matches [190238] (11 species)
    not a true protein
  7. 2726535Species Human (Homo sapiens) [TaxId:9606] [187008] (56 PDB entries)
  8. 2726586Domain d2c74a_: 2c74 A: [163269]
    automated match to d1qjba_
    complexed with cit

Details for d2c74a_

PDB Entry: 2c74 (more details), 2.7 Å

PDB Description: 14-3-3 protein eta (human) complexed to peptide
PDB Compounds: (A:) 14-3-3 protein eta

SCOPe Domain Sequences for d2c74a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c74a_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdreqllqrarlaeqaeryddmasamkavtelneplsnedrnllsvayknvvgarrsswr
vissieqktmadgnekklekvkayrekiekeletvcndvlslldkflikncndfqyeskv
fylkmkgdyyrylaevasgekknsvveaseaaykeafeiskeqmqpthpirlglalnfsv
fyyeiqnapeqacllakqafddaiaeldtlnedsykdstlimqllrdnltlwtsd

SCOPe Domain Coordinates for d2c74a_:

Click to download the PDB-style file with coordinates for d2c74a_.
(The format of our PDB-style files is described here.)

Timeline for d2c74a_: