| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) ![]() |
| Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) |
| Protein automated matches [190540] (4 species) not a true protein |
| Species Human herpesvirus 1 [TaxId:10298] [187512] (2 PDB entries) |
| Domain d2c56a_: 2c56 A: [163263] automated match to d1laue_ |
PDB Entry: 2c56 (more details), 2.1 Å
SCOPe Domain Sequences for d2c56a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c56a_ c.18.1.1 (A:) automated matches {Human herpesvirus 1 [TaxId: 10298]}
ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
pdevrvviigqnpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
rpdprvhcvlkfsnpsplskvpfgtcqhflvanryletrsispidwsv
Timeline for d2c56a_: