Lineage for d2c53a_ (2c53 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855020Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2855021Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2855022Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 2855084Protein automated matches [190540] (4 species)
    not a true protein
  7. 2855092Species Human herpesvirus 1 [TaxId:10298] [187512] (2 PDB entries)
  8. 2855094Domain d2c53a_: 2c53 A: [163262]
    automated match to d1laue_
    complexed with dur, gol

Details for d2c53a_

PDB Entry: 2c53 (more details), 1.8 Å

PDB Description: a comparative study of uracil dna glycosylases from human and herpes simplex virus type 1
PDB Compounds: (A:) uracil DNA glycosylase

SCOPe Domain Sequences for d2c53a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c53a_ c.18.1.1 (A:) automated matches {Human herpesvirus 1 [TaxId: 10298]}
ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
pdevrvviigqnpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
rpdprvhcvlkfsnpsplskvpfgtcqhflvanryletrsispidwsv

SCOPe Domain Coordinates for d2c53a_:

Click to download the PDB-style file with coordinates for d2c53a_.
(The format of our PDB-style files is described here.)

Timeline for d2c53a_: