![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (60 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [187511] (1 PDB entry) |
![]() | Domain d2c41h_: 2c41 H: [163251] automated match to d1jiga_ complexed with cl, pg4, pge |
PDB Entry: 2c41 (more details), 1.81 Å
SCOPe Domain Sequences for d2c41h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c41h_ a.25.1.0 (H:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} ttlkeqvlttlkreqanavvmylnykkyhwltygplfrdlhllfeeqgsevfamidelae rslmldgqpvadpadylkvatvtpssgqltvkqmieeaianheliitemhqdaeiateag digtadlytrlvqthqkhrwflkeflakgdglvs
Timeline for d2c41h_: