Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (19 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [187511] (1 PDB entry) |
Domain d2c41g_: 2c41 G: [163250] automated match to d1jiga_ complexed with cl, pg4, pge |
PDB Entry: 2c41 (more details), 1.81 Å
SCOPe Domain Sequences for d2c41g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c41g_ a.25.1.0 (G:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} ttlkeqvlttlkreqanavvmylnykkyhwltygplfrdlhllfeeqgsevfamidelae rslmldgqpvadpadylkvatvtpssgqltvkqmieeaianheliitemhqdaeiateag digtadlytrlvqthqkhrwflkeflakgdglvs
Timeline for d2c41g_: