SCOP 1.65: Domain d1chua1: 1chu A:423-533

Lineage for d1chua1 (1chu A:423-533)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.7: Spectrin repeat-like [46965] (8 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family)

5. Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)

6. Protein L-aspartate oxidase [46979] (1 species)

7. Species Escherichia coli [TaxId:562] [46980] (3 PDB entries)

8. Domain d1chua1: 1chu A:423-533 [16325]
   Other proteins in same PDB: d1chua2, d1chua3

Details for d1chua1

PDB Entry: 1chu, 2.2 Å

PDB Description: structure of l-aspartate oxidase: implications for the succinate dehydrogenase/ fumarate reducatse family

SCOP Domain Sequences for d1chua1:

Sequence; same for both SEQRES and ATOM records:

>d1chua1 a.7.3.1 (A:423-533) L-aspartate oxidase {Escherichia coli}
desrvenpdervviqhnwhelrlfmwdyvgivrttkrleralrritmlqqeideyyahfr
vsnnllelrnlvqvaelivrcammrkesrglhftldypellthsgpsilsp

Timeline for d1chua1:

• d1chua1 first appeared (with stable ids) in SCOP 1.55
  
• d1chua1 appears in SCOP 1.63
  
• d1chua1 appears in SCOP 1.67
  
• d1chua1 appears in the current release, SCOPe 2.08