Lineage for d1chua1 (1chu A:423-533)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211240Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 211274Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 211275Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 211299Protein L-aspartate oxidase [46979] (1 species)
  7. 211300Species Escherichia coli [TaxId:562] [46980] (3 PDB entries)
  8. 211301Domain d1chua1: 1chu A:423-533 [16325]
    Other proteins in same PDB: d1chua2, d1chua3

Details for d1chua1

PDB Entry: 1chu (more details), 2.2 Å

PDB Description: structure of l-aspartate oxidase: implications for the succinate dehydrogenase/ fumarate reducatse family

SCOP Domain Sequences for d1chua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chua1 a.7.3.1 (A:423-533) L-aspartate oxidase {Escherichia coli}
desrvenpdervviqhnwhelrlfmwdyvgivrttkrleralrritmlqqeideyyahfr
vsnnllelrnlvqvaelivrcammrkesrglhftldypellthsgpsilsp

SCOP Domain Coordinates for d1chua1:

Click to download the PDB-style file with coordinates for d1chua1.
(The format of our PDB-style files is described here.)

Timeline for d1chua1: