| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Thermosynechococcus elongatus [TaxId:197221] [187511] (1 PDB entry) |
| Domain d2c41f_: 2c41 F: [163249] automated match to d1jiga_ complexed with cl, pg4, pge |
PDB Entry: 2c41 (more details), 1.81 Å
SCOPe Domain Sequences for d2c41f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c41f_ a.25.1.0 (F:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
atttlkeqvlttlkreqanavvmylnykkyhwltygplfrdlhllfeeqgsevfamidel
aerslmldgqpvadpadylkvatvtpssgqltvkqmieeaianheliitemhqdaeiate
agdigtadlytrlvqthqkhrwflkeflakgdglvs
Timeline for d2c41f_: