Lineage for d2c41e_ (2c41 E:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1486323Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1486324Protein automated matches [190036] (29 species)
    not a true protein
  7. 1486696Species Thermosynechococcus elongatus [TaxId:197221] [187511] (1 PDB entry)
  8. 1486701Domain d2c41e_: 2c41 E: [163248]
    automated match to d1jiga_
    complexed with cl, pg4, pge

Details for d2c41e_

PDB Entry: 2c41 (more details), 1.81 Å

PDB Description: x-ray structure of dps from thermosynechococcus elongatus
PDB Compounds: (E:) dps family DNA-binding stress response protein

SCOPe Domain Sequences for d2c41e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c41e_ a.25.1.0 (E:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
ttlkeqvlttlkreqanavvmylnykkyhwltygplfrdlhllfeeqgsevfamidelae
rslmldgqpvadpadylkvatvtpssgqltvkqmieeaianheliitemhqdaeiateag
digtadlytrlvqthqkhrwflkeflakgdglvs

SCOPe Domain Coordinates for d2c41e_:

Click to download the PDB-style file with coordinates for d2c41e_.
(The format of our PDB-style files is described here.)

Timeline for d2c41e_: