Lineage for d2c40a_ (2c40 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136733Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2136734Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2136800Family c.70.1.0: automated matches [191403] (1 protein)
    not a true family
  6. 2136801Protein automated matches [190539] (5 species)
    not a true protein
  7. 2136802Species Bacillus anthracis [TaxId:198094] [187509] (1 PDB entry)
  8. 2136803Domain d2c40a_: 2c40 A: [163242]
    automated match to d1hoza_
    complexed with ca, rib

Details for d2c40a_

PDB Entry: 2c40 (more details), 2.2 Å

PDB Description: crystal structure of inosine-uridine preferring nucleoside hydrolase from bacillus anthracis at 2.2a resolution
PDB Compounds: (A:) inosine-uridine preferring nucleoside hydrolase family protein

SCOPe Domain Sequences for d2c40a_:

Sequence, based on SEQRES records: (download)

>d2c40a_ c.70.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 198094]}
mkkvyfnhdggvddlvslflllqmdnveltgvsvipadcylepamsasrkiidrfgknti
evaasnsrgknpfpkdwrmhafyvdalpilnesgkvvthvaakpahhhlietllqteekt
tllftgpltdlaralyeapiienkikrlvwmggtfrtagnvhepehdgtaewnsfwdpea
varvweanieidlitlestnqvpltidireqwakerkyigidflgqcyaivpplvhfakn
styylwdvltaafvgkadlakvqtinsivhtygpsqgrtvetddgrpvhvvydvnhdrff
dyitrlakkv

Sequence, based on observed residues (ATOM records): (download)

>d2c40a_ c.70.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 198094]}
mkkvyfnhdggvddlvslflllqmdnveltgvsvipadcylepamsasrkiidrfgknti
evaasnsrgknpfpkdwrmhafyvdalpilnesgkvvthvaakpahhhlietllqteekt
tllftgpltdlaralyeapiienkikrlvwmggtfrtagnvhepehdgtaewnsfwdpea
varvweanieidlitlestnqvpltidireqwakerkyigidflgqcyaivpplyylwdv
ltaafvgkadlakvqtinsivhtygpsqgrtvetddgrpvhvvydvnhdrffdyitrlak
kv

SCOPe Domain Coordinates for d2c40a_:

Click to download the PDB-style file with coordinates for d2c40a_.
(The format of our PDB-style files is described here.)

Timeline for d2c40a_: