Lineage for d2c3ea_ (2c3e A:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1060942Fold f.42: Mitochondrial carrier [103505] (1 superfamily)
    membrane all-alpha fold; 6-helical "barrel" with internal binding cavity
  4. 1060943Superfamily f.42.1: Mitochondrial carrier [103506] (1 family) (S)
    duplication: consists of three alpha-hairpin repeats
  5. 1060944Family f.42.1.1: Mitochondrial carrier [103507] (2 proteins)
  6. 1060948Protein automated matches [190538] (1 species)
    not a true protein
  7. 1060949Species Cow (Bos taurus) [TaxId:9913] [187508] (1 PDB entry)
  8. 1060950Domain d2c3ea_: 2c3e A: [163240]
    automated match to d1okca_
    complexed with cdl, cxt

Details for d2c3ea_

PDB Entry: 2c3e (more details), 2.8 Å

PDB Description: The bovine mitochondrial ADP-ATP carrier
PDB Compounds: (A:) ADP/ATP translocase 1

SCOPe Domain Sequences for d2c3ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3ea_ f.42.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
sdqalsflkdflaggvaaaisktavapiervklllqvqhaskqisaekqykgiidcvvri
pkeqgflsfwrgnlanviryfptqalnfafkdkykqiflggvdrhkqfwryfagnlasgg
aagatslcfvypldfartrlaadvgkgaaqreftglgncitkifksdglrglyqgfnvsv
qgiiiyraayfgvydtakgmlpdpknvhiivswmiaqtvtavaglvsypfdtvrrrmmmq
sgrkgadimytgtvdcwrkiakdegpkaffkgawsnvlrgmggafvlvlydei

SCOPe Domain Coordinates for d2c3ea_:

Click to download the PDB-style file with coordinates for d2c3ea_.
(The format of our PDB-style files is described here.)

Timeline for d2c3ea_: