![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.42: Mitochondrial carrier [103505] (1 superfamily) membrane all-alpha fold; 6-helical "barrel" with internal binding cavity |
![]() | Superfamily f.42.1: Mitochondrial carrier [103506] (2 families) ![]() duplication: consists of three alpha-hairpin repeats |
![]() | Family f.42.1.1: Mitochondrial carrier [103507] (2 proteins) |
![]() | Protein automated matches [190538] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187508] (1 PDB entry) |
![]() | Domain d2c3ea_: 2c3e A: [163240] automated match to d1okca_ complexed with cdl, cxt |
PDB Entry: 2c3e (more details), 2.8 Å
SCOPe Domain Sequences for d2c3ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c3ea_ f.42.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} sdqalsflkdflaggvaaaisktavapiervklllqvqhaskqisaekqykgiidcvvri pkeqgflsfwrgnlanviryfptqalnfafkdkykqiflggvdrhkqfwryfagnlasgg aagatslcfvypldfartrlaadvgkgaaqreftglgncitkifksdglrglyqgfnvsv qgiiiyraayfgvydtakgmlpdpknvhiivswmiaqtvtavaglvsypfdtvrrrmmmq sgrkgadimytgtvdcwrkiakdegpkaffkgawsnvlrgmggafvlvlydei
Timeline for d2c3ea_: