SCOPe 2.01: Domain d2c2bc_: 2c2b C:

Lineage for d2c2bc_ (2c2b C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein Threonine synthase [64172] (4 species)

7. Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [64173] (3 PDB entries)

8. Domain d2c2bc_: 2c2b C: [163234]
   automated match to d1e5xa_
   complexed with sam, trs

Details for d2c2bc_

PDB Entry: 2c2b, 2.6 Å

PDB Description: crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine

PDB Compounds: (C:) threonine synthase 1, chloroplastic

SCOPe Domain Sequences for d2c2bc_:

Sequence; same for both SEQRES and ATOM records:

>d2c2bc_ c.79.1.1 (C:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}
npfsakyvpfnaapgstesysldeivyrsrsgglldvehdmealkrfdgaywrdlfdsrv
gkstwpygsgvwskkewvlpeiddddivsafegnsnlfwaerfgkqflgmndlwvkhcgi
shtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgcastgdtsaalsaycasagipsivflpa
nkismaqlvqpiangafvlsidtdfdgcmklireitaelpiylanslnslrlegqktaai
eilqqfdwqvpdwvivpggnlgniyafykgfkmcqelglvdriprmvcaqaananplylh
yksgwkdfkpmtasttfasaiqigdpvsidravyalkkcngiveeateeelmdamaqads
tgmficphtgvaltalfklrnqgviaptdrtvvvstahglkftqskidyhsnaipdmacr
fsnppvdvkadfgavmdvlksylg

Timeline for d2c2bc_:

• d2c2bc_ is new in SCOPe 2.01-stable
  
• d2c2bc_ appears in SCOPe 2.02
  
• d2c2bc_ appears in the current release, SCOPe 2.08