Lineage for d2c2bc_ (2c2b C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2139913Protein Threonine synthase [64172] (4 species)
  7. 2139919Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [64173] (3 PDB entries)
  8. 2139926Domain d2c2bc_: 2c2b C: [163234]
    automated match to d1e5xa_
    complexed with plp, sam, trs

Details for d2c2bc_

PDB Entry: 2c2b (more details), 2.6 Å

PDB Description: crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine
PDB Compounds: (C:) threonine synthase 1, chloroplastic

SCOPe Domain Sequences for d2c2bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2bc_ c.79.1.1 (C:) Threonine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
npfsakyvpfnaapgstesysldeivyrsrsgglldvehdmealkrfdgaywrdlfdsrv
gkstwpygsgvwskkewvlpeiddddivsafegnsnlfwaerfgkqflgmndlwvkhcgi
shtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgcastgdtsaalsaycasagipsivflpa
nkismaqlvqpiangafvlsidtdfdgcmklireitaelpiylanslnslrlegqktaai
eilqqfdwqvpdwvivpggnlgniyafykgfkmcqelglvdriprmvcaqaananplylh
yksgwkdfkpmtasttfasaiqigdpvsidravyalkkcngiveeateeelmdamaqads
tgmficphtgvaltalfklrnqgviaptdrtvvvstahglkftqskidyhsnaipdmacr
fsnppvdvkadfgavmdvlksylg

SCOPe Domain Coordinates for d2c2bc_:

Click to download the PDB-style file with coordinates for d2c2bc_.
(The format of our PDB-style files is described here.)

Timeline for d2c2bc_: