Lineage for d2c23a_ (2c23 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333633Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2333634Family a.118.7.1: 14-3-3 protein [48446] (5 protein domains)
  6. 2333684Protein automated matches [190238] (9 species)
    not a true protein
  7. 2333696Species Human (Homo sapiens) [TaxId:9606] [187008] (41 PDB entries)
  8. 2333747Domain d2c23a_: 2c23 A: [163231]
    automated match to d1qjba_

Details for d2c23a_

PDB Entry: 2c23 (more details), 2.65 Å

PDB Description: 14-3-3 Protein Beta (Human) in complex with exoenzyme S peptide
PDB Compounds: (A:) 14-3-3 beta/alpha

SCOPe Domain Sequences for d2c23a_:

Sequence, based on SEQRES records: (download)

>d2c23a_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrsswr
vissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfylk
mkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwts

Sequence, based on observed residues (ATOM records): (download)

>d2c23a_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrsswr
vissieqkkkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfylkmkgdy
frylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfyyeilnsp
ekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwts

SCOPe Domain Coordinates for d2c23a_:

Click to download the PDB-style file with coordinates for d2c23a_.
(The format of our PDB-style files is described here.)

Timeline for d2c23a_: