![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) ![]() |
![]() | Family b.61.1.0: automated matches [191402] (1 protein) not a true family |
![]() | Protein automated matches [190537] (8 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [187505] (2 PDB entries) |
![]() | Domain d2c1sb_: 2c1s B: [163230] automated match to d1avdb_ complexed with bso |
PDB Entry: 2c1s (more details), 1.75 Å
SCOPe Domain Sequences for d2c1sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c1sb_ b.61.1.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} rkcelqglwrnelgsnmtisaldvagtfsgsyqtavtatnkqilvsplkgaqqppgtkgq qptfgftvqwqfadsttvfvgqcfvdrrgkemlemawllreevpsrkdtwkatrvgtnvf trv
Timeline for d2c1sb_: