SCOPe 2.05: Domain d2c1sa_: 2c1s A:

Lineage for d2c1sa_ (2c1s A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.0: automated matches [191402] (1 protein)
   not a true family

6. Protein automated matches [190537] (8 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [187505] (2 PDB entries)

8. Domain d2c1sa_: 2c1s A: [163229]
   automated match to d1avdb_
   complexed with bso

Details for d2c1sa_

PDB Entry: 2c1s, 1.75 Å

PDB Description: x-ray structure of biotin binding protein from chicken

PDB Compounds: (A:) biotin binding protein a

SCOPe Domain Sequences for d2c1sa_:

Sequence; same for both SEQRES and ATOM records:

>d2c1sa_ b.61.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rkcelqglwrnelgsnmtisaldvagtfsgsyqtavtatnkqilvsplkgaqqppgtkgq
qptfgftvqwqfadsttvfvgqcfvdrrgkemlemawllreevpsrkdtwkatrvgtnvf
trv

Timeline for d2c1sa_:

• d2c1sa_ first appeared in SCOPe 2.01
  
• d2c1sa_ appears in SCOPe 2.04
  
• d2c1sa_ appears in SCOPe 2.06
  
• d2c1sa_ appears in the current release, SCOPe 2.08