Lineage for d2c1qa_ (2c1q A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2073248Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2073249Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2073773Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2073774Protein automated matches [190537] (8 species)
    not a true protein
  7. 2073792Species Chicken (Gallus gallus) [TaxId:9031] [187505] (2 PDB entries)
  8. 2073795Domain d2c1qa_: 2c1q A: [163228]
    automated match to d1avdb_
    complexed with btn, gol

Details for d2c1qa_

PDB Entry: 2c1q (more details), 2.1 Å

PDB Description: x-ray structure of biotin binding protein from chicken
PDB Compounds: (A:) biotin binding protein a

SCOPe Domain Sequences for d2c1qa_:

Sequence, based on SEQRES records: (download)

>d2c1qa_ b.61.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
trkcelqglwrnelgsnmtisaldvagtfsgsyqtavtatnkqilvsplkgaqqppgtkg
qqptfgftvqwqfadsttvfvgqcfvdrrgkemlemawllreevpsrkdtwkatrvgtnv
ftrvk

Sequence, based on observed residues (ATOM records): (download)

>d2c1qa_ b.61.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
trkcelqglwrnelgsnmtisaldvagtfsgsyqtavtatnkqilvsplkgaqqppkgqq
ptfgftvqwqfadsttvfvgqcfvdrrgkemlemawllreevpsrkdtwkatrvgtnvft
rvk

SCOPe Domain Coordinates for d2c1qa_:

Click to download the PDB-style file with coordinates for d2c1qa_.
(The format of our PDB-style files is described here.)

Timeline for d2c1qa_: