Lineage for d2c1df_ (2c1d F:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078002Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1078003Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1078555Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1078556Protein automated matches [190453] (9 species)
    not a true protein
  7. 1078569Species Paracoccus pantotrophus [TaxId:82367] [187503] (1 PDB entry)
  8. 1078572Domain d2c1df_: 2c1d F: [163225]
    automated match to d1h31b_
    complexed with hec, zn

Details for d2c1df_

PDB Entry: 2c1d (more details), 1.92 Å

PDB Description: crystal structure of soxxa from p. pantotrophus
PDB Compounds: (F:) soxx

SCOPe Domain Sequences for d2c1df_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1df_ a.3.1.0 (F:) automated matches {Paracoccus pantotrophus [TaxId: 82367]}
cetapkevvyvegaveasltgapgnpeegvrimttnalgncvachqigalpdvefpgtia
ppldgagdrwteaqlrgivanakmtfegtfmpafykvdgfvrpgdgfsgkagaeplapil
naqqiedvvaflvtlke

SCOPe Domain Coordinates for d2c1df_:

Click to download the PDB-style file with coordinates for d2c1df_.
(The format of our PDB-style files is described here.)

Timeline for d2c1df_: