Lineage for d2c18a_ (2c18 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571860Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1572613Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins)
    hybrid of classes I and II aldolase
    automatically mapped to Pfam PF00490
  6. 1572650Protein automated matches [190088] (3 species)
    not a true protein
  7. 1572666Species Pseudomonas aeruginosa [TaxId:287] [187506] (8 PDB entries)
  8. 1572670Domain d2c18a_: 2c18 A: [163219]
    automated match to d1gzgb_
    complexed with cl, mg, na, pge

Details for d2c18a_

PDB Entry: 2c18 (more details), 1.93 Å

PDB Description: 5-(4-carboxy-2-oxo-butane-1-sulfonyl)-4-oxo-pentanoic acid bound to porphobilinogen synthase from pseudomonas aeruginosa
PDB Compounds: (A:) delta-aminolevulinic acid dehydratase

SCOPe Domain Sequences for d2c18a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c18a_ c.1.10.3 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ftpanraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgver
lsidqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpel
giitdvaldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgri
gairealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdea
lhevaadlaegadmvmvxpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwla
esvilesltafkragadgiltyfakqaaeqlrrg

SCOPe Domain Coordinates for d2c18a_:

Click to download the PDB-style file with coordinates for d2c18a_.
(The format of our PDB-style files is described here.)

Timeline for d2c18a_: