Lineage for d2c16b_ (2c16 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086002Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 protein domains)
    hybrid of classes I and II aldolase
    automatically mapped to Pfam PF00490
  6. 2086040Protein automated matches [190088] (5 species)
    not a true protein
  7. 2086043Species Pseudomonas aeruginosa [TaxId:287] [187506] (8 PDB entries)
  8. 2086058Domain d2c16b_: 2c16 B: [163218]
    automated match to d1gzgb_
    complexed with cl, mg, peg, pge

Details for d2c16b_

PDB Entry: 2c16 (more details), 2.02 Å

PDB Description: 5-(4-carboxy-2-oxo-butane-1-sulfinyl)-4-oxo-pentanoic acid acid bound to porphobilinogen synthase from pseudomonas aeruginosa
PDB Compounds: (B:) delta-aminolevulinic acid dehydratase

SCOPe Domain Sequences for d2c16b_:

Sequence, based on SEQRES records: (download)

>d2c16b_ c.1.10.3 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ftpanraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgver
lsidqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpel
giitdvaldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgri
gairealesaghtnvrvmaysaxyasayygpfrdavgsasnlgkgnkatyqmdpansdea
lhevaadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwla
esvilesltafkragadgiltyfakqaaeqlrrg

Sequence, based on observed residues (ATOM records): (download)

>d2c16b_ c.1.10.3 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ftpanraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgver
lsidqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpel
giitdvaldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgri
gairealesaghtnvrvmaysaxyasayygpfrdavgsnkatyqmdpansdealhevaad
laegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesviles
ltafkragadgiltyfakqaaeqlrrg

SCOPe Domain Coordinates for d2c16b_:

Click to download the PDB-style file with coordinates for d2c16b_.
(The format of our PDB-style files is described here.)

Timeline for d2c16b_: