Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins) hybrid of classes I and II aldolase automatically mapped to Pfam PF00490 |
Protein automated matches [190088] (5 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [187506] (8 PDB entries) |
Domain d2c14a_: 2c14 A: [163213] automated match to d1gzgb_ complexed with mg |
PDB Entry: 2c14 (more details), 1.9 Å
SCOPe Domain Sequences for d2c14a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c14a_ c.1.10.3 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} ftpanraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgver lsidqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpel giitdvaldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgri gairealesaghtnvrvmaysaxyasayygpfrdavgsasnlgkgnkatyqmdpansdea lhevaadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwla esvilesltafkragadgiltyfakqaaeqlrrg
Timeline for d2c14a_: