![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins) hybrid of classes I and II aldolase automatically mapped to Pfam PF00490 |
![]() | Protein automated matches [190088] (5 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [187506] (8 PDB entries) |
![]() | Domain d2c13a_: 2c13 A: [163211] automated match to d1gzgb_ complexed with cl, k, mg, peg, pge |
PDB Entry: 2c13 (more details), 2.15 Å
SCOPe Domain Sequences for d2c13a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c13a_ c.1.10.3 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} ftpanraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgver lsidqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpel giitdvaldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgri gairealesaghtnvrvmaysaxyasayygpfrdavgsasnlgkgnkatyqmdpansdea lhevaadlaegadmvmvxpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwla esvilesltafkragadgiltyfakqaaeqlrrg
Timeline for d2c13a_: