![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily) an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity |
![]() | Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) ![]() |
![]() | Family d.278.1.2: TRAPP components [118076] (3 proteins) Pfam PF04051; form homo- and hetero-dimers with the first two helices of one subunit complementing the fold of the other subunit to the H-NOX domain fold |
![]() | Protein automated matches [190535] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187502] (4 PDB entries) |
![]() | Domain d2c0ja_: 2c0j A: [163210] automated match to d1wc8a_ complexed with plm |
PDB Entry: 2c0j (more details), 2.2 Å
SCOPe Domain Sequences for d2c0ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0ja_ d.278.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgrchdfret adviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliysnllcgv lrgalemvqmaveakfvqdtlkgdgvteirmrfirriednl
Timeline for d2c0ja_: