Lineage for d2bzva1 (2bzv A:229-387)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048516Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2048517Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2048732Family b.21.1.0: automated matches [191353] (1 protein)
    not a true family
  6. 2048733Protein automated matches [190378] (6 species)
    not a true protein
  7. 2048765Species Human adenovirus type 41 [TaxId:10524] [187500] (2 PDB entries)
  8. 2048766Domain d2bzva1: 2bzv A:229-387 [163209]
    Other proteins in same PDB: d2bzva2
    automated match to d1p69a_

Details for d2bzva1

PDB Entry: 2bzv (more details), 1.15 Å

PDB Description: human enteric adenovirus serotype 41 short fiber head (ph8)
PDB Compounds: (A:) fiber protein 2

SCOPe Domain Sequences for d2bzva1:

Sequence, based on SEQRES records: (download)

>d2bzva1 b.21.1.0 (A:229-387) automated matches {Human adenovirus type 41 [TaxId: 10524]}
slttiwsisptpncsiyetqdanlflcltkngahvlgtitikglkgalremhdnalslkl
pfdnqgnllncalesstwryqetnavasnaltfmpnstvyprnktahpgnmliqispnit
fsvvyneinsgyaftfkwsaepgkpfhpptavfcyiteq

Sequence, based on observed residues (ATOM records): (download)

>d2bzva1 b.21.1.0 (A:229-387) automated matches {Human adenovirus type 41 [TaxId: 10524]}
slttiwsisptpncsiyetqdanlflcltkngahvlgtitikglkgalremhdnalslkl
pfdnqgnllncalesstwryqetnavasnaltfmpnstvyprnktaitfsvvyneinsgy
aftfkwsaepgkpfhpptavfcyiteq

SCOPe Domain Coordinates for d2bzva1:

Click to download the PDB-style file with coordinates for d2bzva1.
(The format of our PDB-style files is described here.)

Timeline for d2bzva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bzva2