Lineage for d2bzua_ (2bzu A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2777097Family b.21.1.0: automated matches [191353] (1 protein)
    not a true family
  6. 2777098Protein automated matches [190378] (9 species)
    not a true protein
  7. 2777164Species Human adenovirus type 41 [TaxId:10524] [187500] (2 PDB entries)
  8. 2777166Domain d2bzua_: 2bzu A: [163208]
    automated match to d1p69a_

Details for d2bzua_

PDB Entry: 2bzu (more details), 1.5 Å

PDB Description: human adenovirus serotype 41 fiber head
PDB Compounds: (A:) fiber protein 2

SCOPe Domain Sequences for d2bzua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bzua_ b.21.1.0 (A:) automated matches {Human adenovirus type 41 [TaxId: 10524]}
slttiwsisptpncsiyetqdanlflcltkngahvlgtitikglkgalremhdnalslkl
pfdnqgnllncalesstwryqetnavasnaltfmpnstvyprnktahpgnmliqispnit
fsvvyneinsgyaftfkwsaepgkpfhpptavfcyiteq

SCOPe Domain Coordinates for d2bzua_:

Click to download the PDB-style file with coordinates for d2bzua_.
(The format of our PDB-style files is described here.)

Timeline for d2bzua_: