SCOPe 2.06: Domain d2bxwb_: 2bxw B:

Lineage for d2bxwb_ (2bxw B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein automated matches [190534] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187499] (10 PDB entries)

8. Domain d2bxwb_: 2bxw B: [163205]
   automated match to d1ft3a_
   complexed with fmt, trs; mutant

Details for d2bxwb_

PDB Entry: 2bxw, 2.4 Å

PDB Description: crystal structure of rhogdi lys(135,138,141)tyr mutant

PDB Compounds: (B:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d2bxwb_:

Sequence; same for both SEQRES and ATOM records:

>d2bxwb_ b.1.18.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrygvyidytdymvgsygpraeeyefltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw

Timeline for d2bxwb_:

• d2bxwb_ first appeared in SCOPe 2.01
  
• d2bxwb_ appears in SCOPe 2.05
  
• d2bxwb_ appears in SCOPe 2.07
  
• d2bxwb_ appears in the current release, SCOPe 2.08