| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
| Protein automated matches [190534] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187499] (10 PDB entries) |
| Domain d2bxwa_: 2bxw A: [163204] automated match to d1ft3a_ complexed with fmt, trs; mutant |
PDB Entry: 2bxw (more details), 2.4 Å
SCOPe Domain Sequences for d2bxwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bxwa_ b.1.18.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrygvyidytdymvgsygpraeeyefltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw
Timeline for d2bxwa_: