Lineage for d2bx4a_ (2bx4 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2389935Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2389994Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
    contains an extra alpha-helical domain
  7. 2390013Species Sars coronavirus sin2774 [TaxId:235410] [187498] (2 PDB entries)
  8. 2390015Domain d2bx4a_: 2bx4 A: [163203]
    automated match to d1uj1b_

Details for d2bx4a_

PDB Entry: 2bx4 (more details), 2.79 Å

PDB Description: crystal structure of sars coronavirus main proteinase (p21212)
PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d2bx4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bx4a_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Sars coronavirus sin2774 [TaxId: 235410]}
frkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirks
nhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngsp
sgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkfy
gpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyepl
tqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc

SCOPe Domain Coordinates for d2bx4a_:

Click to download the PDB-style file with coordinates for d2bx4a_.
(The format of our PDB-style files is described here.)

Timeline for d2bx4a_: