![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
![]() | Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
![]() | Protein automated matches [190061] (7 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187495] (5 PDB entries) |
![]() | Domain d2bwla_: 2bwl A: [163201] automated match to d1a4yb_ complexed with po4 |
PDB Entry: 2bwl (more details), 1.62 Å
SCOPe Domain Sequences for d2bwla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwla_ d.5.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ddsrytkfltqhhdakpkgrddrycermmkrrsltspckdvntfihgnksnikaicgang spyrenlrmskspfqvttckhtggsprppcqyrasagfrhvviacenglpvhfdesff
Timeline for d2bwla_: