Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein automated matches [190061] (7 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187495] (5 PDB entries) |
Domain d2bwka_: 2bwk A: [163200] automated match to d1a4yb_ complexed with so4 |
PDB Entry: 2bwk (more details), 1.5 Å
SCOPe Domain Sequences for d2bwka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwka_ d.5.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dsrytkfltqhhdakpkgrddrycermmkrrsltspckdvntfihgnksnikaicgangs pyrenlrmskspfqvttckhtggsprppcqyrasagfrhvviacenglpvhfdesffs
Timeline for d2bwka_: