SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2bwje_ (2bwj E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (119 species)
    not a true protein
  7. 2114207Species Human (Homo sapiens) [TaxId:9606] [186862] (115 PDB entries)
  8. 2114273Domain d2bwje_: 2bwj E: [163198]
    automated match to d3adka_
    complexed with amp, cl, so4

Details for d2bwje_

PDB Entry: 2bwj (more details), 2.3 Å

PDB Description: structure of adenylate kinase 5
PDB Compounds: (E:) adenylate kinase 5

SCOPe Domain Sequences for d2bwje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwje_ c.37.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrkckiifiiggpgsgkgtqceklvekygfthlstgellreelasesersklirdimerg
dlvpsgivlellkeamvaslgdtrgflidgyprevkqgeefgrrigdpqlvicmdcsadt
mtnrllqmsrsslpvddttktiakrleayyrasipviayyetktqlhkinaegtpedvfl
qlctaidsif

SCOPe Domain Coordinates for d2bwje_:

Click to download the PDB-style file with coordinates for d2bwje_.
(The format of our PDB-style files is described here.)

Timeline for d2bwje_: