Lineage for d2bwjd_ (2bwj D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 990511Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 990512Protein automated matches [190123] (20 species)
    not a true protein
  7. 990528Species Human (Homo sapiens) [TaxId:9606] [186862] (23 PDB entries)
  8. 990547Domain d2bwjd_: 2bwj D: [163197]
    automated match to d3adka_
    complexed with amp, cl, so4

Details for d2bwjd_

PDB Entry: 2bwj (more details), 2.3 Å

PDB Description: structure of adenylate kinase 5
PDB Compounds: (D:) adenylate kinase 5

SCOPe Domain Sequences for d2bwjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwjd_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
medlrkckiifiiggpgsgkgtqceklvekygfthlstgellreelasesersklirdim
ergdlvpsgivlellkeamvaslgdtrgflidgyprevkqgeefgrrigdpqlvicmdcs
adtmtnrllqmsrsslpvddttktiakrleayyrasipviayyetktqlhkinaegtped
vflqlctaidsi

SCOPe Domain Coordinates for d2bwjd_:

Click to download the PDB-style file with coordinates for d2bwjd_.
(The format of our PDB-style files is described here.)

Timeline for d2bwjd_: