Lineage for d2bw7d_ (2bw7 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954779Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954780Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 2954841Protein automated matches [190310] (3 species)
    not a true protein
  7. 2954848Species Spirulina platensis [TaxId:118562] [187494] (1 PDB entry)
  8. 2954852Domain d2bw7d_: 2bw7 D: [163193]
    Other proteins in same PDB: d2bw7a2, d2bw7b2, d2bw7c2
    automated match to d1wc4a_
    complexed with apc, ca, ecs, mg

Details for d2bw7d_

PDB Entry: 2bw7 (more details), 2.3 Å

PDB Description: a novel mechanism for adenylyl cyclase inhibition from the crystal structure of its complex with catechol estrogen
PDB Compounds: (D:) adenylate cyclase

SCOPe Domain Sequences for d2bw7d_:

Sequence, based on SEQRES records: (download)

>d2bw7d_ d.58.29.1 (D:) automated matches {Spirulina platensis [TaxId: 118562]}
rpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdaim
alygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgihqgm
avvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelk
gidepvmtcvinpnm

Sequence, based on observed residues (ATOM records): (download)

>d2bw7d_ d.58.29.1 (D:) automated matches {Spirulina platensis [TaxId: 118562]}
rpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdaim
alygapeemspseqvrraiatarqmlvaleklnqgwqerglvgevppvrfrcgihqgmav
vglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelkgi
depvmtcvinpnm

SCOPe Domain Coordinates for d2bw7d_:

Click to download the PDB-style file with coordinates for d2bw7d_.
(The format of our PDB-style files is described here.)

Timeline for d2bw7d_: