![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) ![]() common fold is elaborated with additional secondary structures |
![]() | Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins) Pfam PF00211 structurally similar to the "palm" domain of DNA/RNA polymerase superfamily |
![]() | Protein automated matches [190310] (3 species) not a true protein |
![]() | Species Spirulina platensis [TaxId:118562] [187494] (1 PDB entry) |
![]() | Domain d2bw7b1: 2bw7 B:1005-1199 [163191] Other proteins in same PDB: d2bw7a2, d2bw7b2, d2bw7c2 automated match to d1wc4a_ complexed with apc, ca, ecs, mg |
PDB Entry: 2bw7 (more details), 2.3 Å
SCOPe Domain Sequences for d2bw7b1:
Sequence, based on SEQRES records: (download)
>d2bw7b1 d.58.29.1 (B:1005-1199) automated matches {Spirulina platensis [TaxId: 118562]} rpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdaim alygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgihqgm avvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelk gidepvmtcvinpnm
>d2bw7b1 d.58.29.1 (B:1005-1199) automated matches {Spirulina platensis [TaxId: 118562]} rpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdaim alygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrppvrfrcgihqgmavv glfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelkgid epvmtcvinpnm
Timeline for d2bw7b1: