SCOP 1.57: Domain d1aj3__: 1aj3 -

Lineage for d1aj3__ (1aj3 -)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)

4. Superfamily a.7.1: Spectrin repeat [46966] (1 family)

5. Family a.7.1.1: Spectrin repeat [46967] (2 proteins)
   this is a repeat family; one repeat unit is 1hci A:512-632 found in domain

6. Protein Spectrin [46968] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [46970] (2 PDB entries)

8. Domain d1aj3__: 1aj3 - [16319]

Details for d1aj3__

PDB Entry: 1aj3

PDB Description: solution structure of the spectrin repeat, nmr, 20 structures

SCOP Domain Sequences for d1aj3__:

Sequence; same for both SEQRES and ATOM records:

>d1aj3__ a.7.1.1 (-) Spectrin {Chicken (Gallus gallus)}
hqffrdmddeeswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqgvldt
gkklsddntigkeeiqqrlaqfvdhwkelkqlaaargq

Timeline for d1aj3__:

• d1aj3__ first appeared (with stable ids) in SCOP 1.55
  
• d1aj3__ appears in SCOP 1.59
  
• d1aj3__ appears in the current release, SCOPe 2.08, called d1aj3a_