Lineage for d1aj3__ (1aj3 -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1840Fold a.7: Spectrin repeat-like [46965] (6 superfamilies)
  4. 1841Superfamily a.7.1: Spectrin repeat [46966] (1 family) (S)
  5. 1842Family a.7.1.1: Spectrin repeat [46967] (2 proteins)
    this is a repeat family; one repeat unit is 1hci A:512-632 found in domain
  6. 1847Protein Spectrin [46968] (2 species)
  7. Species Chicken (Gallus gallus) [TaxId:9031] [46970] (2 PDB entries)
  8. 1855Domain d1aj3__: 1aj3 - [16319]

Details for d1aj3__

PDB Entry: 1aj3 (more details)

PDB Description: solution structure of the spectrin repeat, nmr, 20 structures

SCOP Domain Sequences for d1aj3__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aj3__ a.7.1.1 (-) Spectrin {Chicken (Gallus gallus)}
hqffrdmddeeswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqgvldt
gkklsddntigkeeiqqrlaqfvdhwkelkqlaaargq

SCOP Domain Coordinates for d1aj3__:

Click to download the PDB-style file with coordinates for d1aj3__.
(The format of our PDB-style files is described here.)

Timeline for d1aj3__: