SCOPe 2.08: Domain d1aj3a_: 1aj3 A:

Lineage for d1aj3a_ (1aj3 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.1: Spectrin repeat [46966] (2 families)

5. Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
   this is a repeat family; one repeat unit is 1hci A:512-632 found in domain

6. Protein Spectrin alpha chain [46968] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries)
   Uniprot P07751 1662-1981

8. Domain d1aj3a_: 1aj3 A: [16319]
   monomeric NMR structure

Details for d1aj3a_

PDB Entry: 1aj3

PDB Description: solution structure of the spectrin repeat, nmr, 20 structures

PDB Compounds: (A:) alpha spectrin

SCOPe Domain Sequences for d1aj3a_:

Sequence; same for both SEQRES and ATOM records:

>d1aj3a_ a.7.1.1 (A:) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}
hqffrdmddeeswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqgvldt
gkklsddntigkeeiqqrlaqfvdhwkelkqlaaargq

Timeline for d1aj3a_:

• d1aj3a_ first appeared (with stable ids) in SCOP 1.55, called d1aj3__
  
• d1aj3a_ appears in SCOPe 2.07