Lineage for d2bvud_ (2bvu D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2374559Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2374652Family b.1.11.2: MSP-like [49360] (4 proteins)
    Pfam PF00635
  6. 2374653Protein Major sperm protein, MSP [49361] (2 species)
  7. 2374659Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (4 PDB entries)
  8. 2374665Domain d2bvud_: 2bvu D: [163189]
    automated match to d3mspa_
    mutant

Details for d2bvud_

PDB Entry: 2bvu (more details), 2.5 Å

PDB Description: d83r mutant of asaris suum major sperm protein (msp)
PDB Compounds: (D:) major sperm protein, isoform alpha

SCOPe Domain Sequences for d2bvud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvud_ b.1.11.2 (D:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]}
svppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcgvl
dpkekvlmavscdtfnaaterlnndritiewtntpdgaakqfrrewfqgdgmvrrknlpi
eynl

SCOPe Domain Coordinates for d2bvud_:

Click to download the PDB-style file with coordinates for d2bvud_.
(The format of our PDB-style files is described here.)

Timeline for d2bvud_: