Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (3 families) contains PP switch between strands D and C' |
Family b.1.11.2: MSP-like [49360] (4 proteins) Pfam PF00635 |
Protein Major sperm protein, MSP [49361] (2 species) |
Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (4 PDB entries) |
Domain d2bvuc_: 2bvu C: [163188] automated match to d3mspa_ mutant |
PDB Entry: 2bvu (more details), 2.5 Å
SCOPe Domain Sequences for d2bvuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvuc_ b.1.11.2 (C:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]} vppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcgvld pkekvlmavscdtfnaaterlnndritiewtntpdgaakqfrrewfqgdgmvrrknlpie ynl
Timeline for d2bvuc_: