SCOPe 2.05: Domain d2bvuc_: 2bvu C:

Lineage for d2bvuc_ (2bvu C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.2: MSP-like [49360] (4 proteins)
   Pfam PF00635

6. Protein Major sperm protein, MSP [49361] (2 species)

7. Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (4 PDB entries)

8. Domain d2bvuc_: 2bvu C: [163188]
   automated match to d3mspa_
   mutant

Details for d2bvuc_

PDB Entry: 2bvu, 2.5 Å

PDB Description: d83r mutant of asaris suum major sperm protein (msp)

PDB Compounds: (C:) major sperm protein, isoform alpha

SCOPe Domain Sequences for d2bvuc_:

Sequence; same for both SEQRES and ATOM records:

>d2bvuc_ b.1.11.2 (C:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]}
vppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcgvld
pkekvlmavscdtfnaaterlnndritiewtntpdgaakqfrrewfqgdgmvrrknlpie
ynl

Timeline for d2bvuc_:

• d2bvuc_ first appeared in SCOPe 2.01
  
• d2bvuc_ appears in SCOPe 2.04
  
• d2bvuc_ appears in SCOPe 2.06
  
• d2bvuc_ appears in the current release, SCOPe 2.08