Lineage for d2bvub_ (2bvu B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299054Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 1299143Family b.1.11.2: MSP-like [49360] (4 proteins)
    Pfam PF00635
  6. 1299144Protein Major sperm protein, MSP [49361] (2 species)
  7. 1299150Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (4 PDB entries)
  8. 1299152Domain d2bvub_: 2bvu B: [163187]
    automated match to d3mspa_
    mutant

Details for d2bvub_

PDB Entry: 2bvu (more details), 2.5 Å

PDB Description: d83r mutant of asaris suum major sperm protein (msp)
PDB Compounds: (B:) major sperm protein, isoform alpha

SCOPe Domain Sequences for d2bvub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvub_ b.1.11.2 (B:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]}
vppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcgvld
pkekvlmavscdtfnaaterlnndritiewtntpdgaakqfrrewfqgdgmvrrknlpie
ynl

SCOPe Domain Coordinates for d2bvub_:

Click to download the PDB-style file with coordinates for d2bvub_.
(The format of our PDB-style files is described here.)

Timeline for d2bvub_: