SCOPe 2.01: Domain d2bvua_: 2bvu A:

Lineage for d2bvua_ (2bvu A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.2: MSP-like [49360] (4 proteins)
   Pfam PF00635

6. Protein Major sperm protein, MSP [49361] (2 species)

7. Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (4 PDB entries)

8. Domain d2bvua_: 2bvu A: [163186]
   automated match to d3mspa_
   mutant

Details for d2bvua_

PDB Entry: 2bvu, 2.5 Å

PDB Description: d83r mutant of asaris suum major sperm protein (msp)

PDB Compounds: (A:) major sperm protein, isoform alpha

SCOPe Domain Sequences for d2bvua_:

Sequence; same for both SEQRES and ATOM records:

>d2bvua_ b.1.11.2 (A:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]}
vppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcgvld
pkekvlmavscdtfnaaterlnndritiewtntpdgaakqfrrewfqgdgmvrrknlpie
ynl

Timeline for d2bvua_:

• d2bvua_ is new in SCOPe 2.01-stable
  
• d2bvua_ appears in SCOPe 2.02
  
• d2bvua_ appears in the current release, SCOPe 2.08