Class a: All alpha proteins [46456] (226 folds) |
Fold a.7: Spectrin repeat-like [46965] (13 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.1: Spectrin repeat [46966] (1 family) |
Family a.7.1.1: Spectrin repeat [46967] (3 proteins) this is a repeat family; one repeat unit is 1hci A:512-632 found in domain |
Protein Spectrin alpha chain [46968] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries) |
Domain d1cunc2: 1cun C:116-219 [16318] repeats 16 and 17 mutant |
PDB Entry: 1cun (more details), 2 Å
SCOP Domain Sequences for d1cunc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cunc2 a.7.1.1 (C:116-219) Spectrin alpha chain {Chicken (Gallus gallus)} qfvanveeeeawinekmtlvasedygdtlaaiqgllkkheafetdftvhkdrvndvcang edlikknnhhvenitakmkglkgkvsdlekaaaqrkakldensa
Timeline for d1cunc2:
View in 3D Domains from other chains: (mouse over for more information) d1cuna1, d1cuna2, d1cunb1, d1cunb2 |