| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.7: Spectrin repeat-like [46965] (7 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.1: Spectrin repeat [46966] (1 family) ![]() |
| Family a.7.1.1: Spectrin repeat [46967] (2 proteins) this is a repeat family; one repeat unit is 1hci A:512-632 found in domain |
| Protein Spectrin [46968] (2 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [46970] (2 PDB entries) |
| Domain d1cunc2: 1cun C:116-219 [16318] repeats 16 and 17 of alpha spectrin mutant |
PDB Entry: 1cun (more details), 2 Å
SCOP Domain Sequences for d1cunc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cunc2 a.7.1.1 (C:116-219) Spectrin {Chicken (Gallus gallus)}
qfvanveeeeawinekmtlvasedygdtlaaiqgllkkheafetdftvhkdrvndvcang
edlikknnhhvenitakmkglkgkvsdlekaaaqrkakldensa
Timeline for d1cunc2:
View in 3DDomains from other chains: (mouse over for more information) d1cuna1, d1cuna2, d1cunb1, d1cunb2 |