Lineage for d1cunc2 (1cun C:116-219)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 95722Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
  4. 95723Superfamily a.7.1: Spectrin repeat [46966] (1 family) (S)
  5. 95724Family a.7.1.1: Spectrin repeat [46967] (2 proteins)
    this is a repeat family; one repeat unit is 1hci A:512-632 found in domain
  6. 95737Protein Spectrin [46968] (2 species)
  7. 95738Species Chicken (Gallus gallus) [TaxId:9031] [46970] (2 PDB entries)
  8. 95744Domain d1cunc2: 1cun C:116-219 [16318]

Details for d1cunc2

PDB Entry: 1cun (more details), 2 Å

PDB Description: crystal structure of repeats 16 and 17 of chicken brain alpha spectrin

SCOP Domain Sequences for d1cunc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cunc2 a.7.1.1 (C:116-219) Spectrin {Chicken (Gallus gallus)}
qfvanveeeeawinekmtlvasedygdtlaaiqgllkkheafetdftvhkdrvndvcang
edlikknnhhvenitakmkglkgkvsdlekaaaqrkakldensa

SCOP Domain Coordinates for d1cunc2:

Click to download the PDB-style file with coordinates for d1cunc2.
(The format of our PDB-style files is described here.)

Timeline for d1cunc2: