Lineage for d2bv8f_ (2bv8 F:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1255931Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1256091Protein automated matches [190531] (8 species)
    not a true protein
  7. 1256132Species Red algae (Gracilaria chilensis) [TaxId:2775] [187492] (1 PDB entry)
  8. 1256138Domain d2bv8f_: 2bv8 F: [163177]
    automated match to d1phnb_
    complexed with cyc, peb

Details for d2bv8f_

PDB Entry: 2bv8 (more details), 2.01 Å

PDB Description: the crystal structure of phycocyanin from gracilaria chilensis.
PDB Compounds: (F:) c-phycocyanin beta subunit

SCOPe Domain Sequences for d2bv8f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bv8f_ a.1.1.3 (F:) automated matches {Red algae (Gracilaria chilensis) [TaxId: 2775]}
mldafakvvaqadargeflsntqldalanmiaegnkrldivnrinsnasaivsnsaralf
aeqpqliqpggnaytnrrmaaclrdmeivlryvsyaeiagdssvlddrclnglretyqal
gtpgssvavaiekmkeasvsdandssgtpsgdcsslsaelgtyfdraasavs

SCOPe Domain Coordinates for d2bv8f_:

Click to download the PDB-style file with coordinates for d2bv8f_.
(The format of our PDB-style files is described here.)

Timeline for d2bv8f_: