Lineage for d2bv8e_ (2bv8 E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979008Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1979193Protein automated matches [190531] (18 species)
    not a true protein
  7. 1979431Species Red algae (Gracilaria chilensis) [TaxId:2775] [187492] (2 PDB entries)
  8. 1979436Domain d2bv8e_: 2bv8 E: [163176]
    automated match to d1phna_
    complexed with cyc, peb

Details for d2bv8e_

PDB Entry: 2bv8 (more details), 2.01 Å

PDB Description: the crystal structure of phycocyanin from gracilaria chilensis.
PDB Compounds: (E:) c-phycocyanin alpha subunit

SCOPe Domain Sequences for d2bv8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bv8e_ a.1.1.3 (E:) automated matches {Red algae (Gracilaria chilensis) [TaxId: 2775]}
mktpiteaiasadsqgrflsngelqsingryqratasleaarsltsnaerlisgaaqsvy
skfpyttqmqgpnyaadatgkakcardigyylrmvtyclvvgatgpmdeyliaglseinr
sfelspswyiealeyikdshalsgqaaneantyldyainals

SCOPe Domain Coordinates for d2bv8e_:

Click to download the PDB-style file with coordinates for d2bv8e_.
(The format of our PDB-style files is described here.)

Timeline for d2bv8e_: